Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Lepti (LEP)

Recombinant Pig Lepti (LEP)

Product Specifications

Product Name Alternative

Obesity factor

UniProt

Q29406

Expression Region

22-167aa

Tag

C-terminal mFc2a-tagged

Source

Mammalian cell

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.22.

AA Sequence

VPIWRVQDDTKTLIKTIVTRISDISHMQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARALETLESLGGVLEASLYSTEVVALSRLQGALQDMLRQLDLSPGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UPF0598 protein C8orf82, C8orf82 ELISA KIT
ELI-33481h 96 Tests

Human UPF0598 protein C8orf82, C8orf82 ELISA KIT

Sign In for Pricing
View Details
PRKACA (NM_207518) Human Over-expression Lysate
E45H16847-2 20 µg

PRKACA (NM_207518) Human Over-expression Lysate

Sign In for Pricing
View Details
CD55 3'UTR GFP Stable Cell Line
TU053900 1.0 mL

CD55 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SUMO-2/3 Antibody [SPM572]
34-165 100 µg

SUMO-2/3 Antibody [SPM572]

Sign In for Pricing
View Details
hsa-miR-6744-3p miRNA Mimic
MBS8300200-01 5 nmol

hsa-miR-6744-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-6744-3p miRNA Mimic
MBS8300200-02 10 nmol

hsa-miR-6744-3p miRNA Mimic

Sign In for Pricing
View Details