Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 7 (FGF7)

Recombinant Human Fibroblast growth factor 7 (FGF7)

Product Specifications

Product Name Alternative

Heparin-binding growth factor 7; Keratinocyte growth factor

UniProt

P21781

Expression Region

32-194aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.15.

AA Sequence

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ginkgolic acid 2-phosphate
T85072-01 10 mg

Ginkgolic acid 2-phosphate

Sign In for Pricing
View Details
Ginkgolic acid 2-phosphate
T85072-02 50 mg

Ginkgolic acid 2-phosphate

Sign In for Pricing
View Details
Calothrix sp. NIES-2098 NIES2098_06580/NIES Rabbit Polyclonal Antibody
orb2569887 200 µL

Calothrix sp. NIES-2098 NIES2098_06580/NIES Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FL-411
BA4718-10 10 mg

FL-411

Sign In for Pricing
View Details
Recombinant Human AKR1C3 (C-6His)
PHH0099-01 10 µg

Recombinant Human AKR1C3 (C-6His)

Sign In for Pricing
View Details
Recombinant Human AKR1C3 (C-6His)
PHH0099-02 50 µg

Recombinant Human AKR1C3 (C-6His)

Sign In for Pricing
View Details