Recombinant Human C-C chemokine receptor type 7 (CCR7) -VLPs
Recombinant Human C-C chemokine receptor type 7 (CCR7) -VLPs
Product Specifications
Product Name Alternative
BLR2; CDw197; Epstein-Barr virus-induced G-protein coupled receptor 1; MIP-3 beta receptor
UniProt
P32248
Expression Region
25-378aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
The purity information is not available for VLPs proteins.
Form
Lyophilized powder
Molecular Weight
41.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
AA Sequence
QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402641-100 1x 100 µL
Prolactin (Pituitary Tumor Marker) (PRL/2641), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881864-100 1x 100 µL
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details