Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Amphiregulin (Areg), partial

Recombinant Mouse Amphiregulin (Areg), partial

Product Specifications

Product Name Alternative

Schwannoma-derived growth factor

UniProt

P31955

Expression Region

100-191aa

Tag

N-terminal hFc1-tagged and C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.1.

AA Sequence

VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VEGF165 ELISA Kit
orb564601-01 48 Tests

Human VEGF165 ELISA Kit

Sign In for Pricing
View Details
Human VEGF165 ELISA Kit
orb564601-02 96 Tests

Human VEGF165 ELISA Kit

Sign In for Pricing
View Details
ANT4 discontinued
385851 200 µL

ANT4 discontinued

Sign In for Pricing
View Details
CD204/MSR1 Protein, Rat, Recombinant (His Tag)
E45R53808M1-100 100 µg

CD204/MSR1 Protein, Rat, Recombinant (His Tag)

Sign In for Pricing
View Details
MK-0343
orb1706979-01 1 mg

MK-0343

Sign In for Pricing
View Details
MK-0343
orb1706979-02 5 mg

MK-0343

Sign In for Pricing
View Details