Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial (Active)

Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial (Active)

Product Specifications

Product Name Alternative

Epithelial cell adhesion molecule; Ep-CAM; Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; Epithelial cell surface antigen; Epithelial glycoprotein; EGP; Epithelial glycoprotein 314; EGP314; hEGP314; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; Tumor-associated calcium signal transducer 1; CD antigen CD326

UniProt

P16422

Expression Region

24-265aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Human EPCAM at 2 μg/mL can bind Anti-EPCAM recombinant antibody. The EC50 is 1.098-1.401 ng/mL. 2EPCAM Recombinant Monoclonal Antibody captured on Protein A Chip can bind Human EPCAM with an affinity constant of 0.742 nM as detected by MetaSPR Assay.

Form

Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-054522
HY-120287 1 Each

L-054522

Sign In for Pricing
View Details
Anti-JAK3 antibody R1G - 2mg/mL
CRB2005650_1 20 µg

Anti-JAK3 antibody R1G - 2mg/mL

Sign In for Pricing
View Details
Tryptophanamide
T26297 25 mg

Tryptophanamide

Sign In for Pricing
View Details
Anti-REA/PHB2 Antibody Picoband® (monoclonal, 2B5) Fluoro488 Conjugated
M03315-Fluoro488 100 µg/Vial

Anti-REA/PHB2 Antibody Picoband® (monoclonal, 2B5) Fluoro488 Conjugated

Sign In for Pricing
View Details
FAM83A Protein Vector (Human) (pPB-N-His)
PV015606 500 ng

FAM83A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human GRK6 Protein, N-His
HW528012-01 50 µg

Recombinant Human GRK6 Protein, N-His

Sign In for Pricing
View Details