Recombinant Macaca fascicularis Ig-like domain-containing protein (EGM_15593), partial (Active)
Recombinant Macaca fascicularis Ig-like domain-containing protein (EGM_15593), partial (Active)
Product Specifications
Product Name Alternative
Ig-like domain-containing protein
UniProt
G7P6Q7
Expression Region
22-201aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Purity
Greater than 90% as determined by SDS-PAGE.
Bioactivity
1Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis HAVCR2 at 2 μg/mL can bind Anti-HAVCR2 recombinant antibody. The EC50 is 1.062-1.282 ng/mL. 2Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis HAVCR2 at 2 μg/mL can bind Anti-HAVCR2 recombinant antibody. The EC50 is 4.000-4.556 ng/mL. 3HAVCR2 Recombinant Monoclonal Antibody captured on Protein A Chip can bind Recombinant Macaca fascicularis HAVCR2 with an affinity constant of 6.94 nM as detected by MetaSPR Assay. 4HAVCR2 Recombinant Monoclonal Antibody captured on Protein A Chip can bind Recombinant Macaca fascicularis HAVCR2 with an affinity constant of 5.82 nM as detected by MetaSPR Assay.
Form
Lyophilized powder
Molecular Weight
21.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
SEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRDSGATIR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog