Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BGLAP, Mouse (His-SUMO)

The BGLAP protein, in its carboxylated state, forms an important part of the bone matrix and acts as a negative regulator of bone formation. It limits bone formation and preserves processes such as resorption and mineralization. BGLAP Protein, Mouse (His-SUMO) is the recombinant mouse-derived BGLAP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

BGLAP Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bglap-protein-mouse-his-sumo.html

Purity

90.00

Smiles

YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI

Molecular Formula

12096 (Gene_ID) P86546 (Y50-I95) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-874-3p miRNA Mimic
CMM0492-01 5 nmol

Mmu-miR-874-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-874-3p miRNA Mimic
CMM0492-02 10 nmol

Mmu-miR-874-3p miRNA Mimic

Sign In for Pricing
View Details
FOXD4L6 HDR Plasmid (h)
sc-417059-HDR 20 µg

FOXD4L6 HDR Plasmid (h)

Sign In for Pricing
View Details
HDAC4 (D8T3Q) Rabbit Monoclonal Antibody
CST 15164S 100 µL

HDAC4 (D8T3Q) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SLFN12L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2195205 3x 1.0 µg

SLFN12L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Urod sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3376908 1.0 µg DNA

Urod sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details