Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hoxd1 (NM_010467) Mouse Tagged Lenti ORF Clone
MR216599L4 10 µg

Hoxd1 (NM_010467) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
pExpress-1-Rbm34 Plasmid
PVT54946 2 µg

pExpress-1-Rbm34 Plasmid

Sign In for Pricing
View Details
Cavy UPF0451 Protein C17orf61 (C17OFR61) ELISA Kit
MBS9354749 Inquire

Cavy UPF0451 Protein C17orf61 (C17OFR61) ELISA Kit

Sign In for Pricing
View Details
Anti-Rabbit IgG (H+L), Human Serum Adsorbed - 10nm Gold Conjugate
AC-10-17-10 0.5 mL

Anti-Rabbit IgG (H+L), Human Serum Adsorbed - 10nm Gold Conjugate

Sign In for Pricing
View Details
Mia2 (NM_001165253) Mouse Tagged ORF Clone
MR216815 10 µg

Mia2 (NM_001165253) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TMLHE sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
47127111 3x 1.0 µg

TMLHE sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details