Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amino-PEG6-amine
571833 250.0mg

Amino-PEG6-amine

Sign In for Pricing
View Details
FoxD3 Monoclonal Antibody
BT-MCA0565-01 50 µL

FoxD3 Monoclonal Antibody

Sign In for Pricing
View Details
FoxD3 Monoclonal Antibody
BT-MCA0565-02 100 µL

FoxD3 Monoclonal Antibody

Sign In for Pricing
View Details
RGS8 Protein Lysate (Mouse) with C-HA Tag
39487034 100 µg

RGS8 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Anti-DRD5 antibody
PAab02534 100 µg

Anti-DRD5 antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) yjjX Polyclonal Antibody
MBS7157482 Inquire

Rabbit anti-Escherichia coli (strain K12) yjjX Polyclonal Antibody

Sign In for Pricing
View Details