Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLUAP1 (NM_024793) Human Tagged Lenti ORF Clone
RC213430L3 10 µg

CLUAP1 (NM_024793) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal HDAC3 Antibody (PCRP-HDAC3-2D4) [Alexa Fluor 700]
NBP3-14060AF700 0.1 mL

Mouse Monoclonal HDAC3 Antibody (PCRP-HDAC3-2D4) [Alexa Fluor 700]

Sign In for Pricing
View Details
REXO4 (NM_020385) Human Tagged ORF Clone
RG202528 10 µg

REXO4 (NM_020385) Human Tagged ORF Clone

Sign In for Pricing
View Details
Donkey UPF0467 Protein C5orf32 (C5ORF32) ELISA Kit
MBS9933528 Inquire

Donkey UPF0467 Protein C5orf32 (C5ORF32) ELISA Kit

Sign In for Pricing
View Details
RPL24P5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV778834 1.0 µg DNA

RPL24P5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Levomefolic acid-13C, d3
HY-14781S1-01 500 µg

Levomefolic acid-13C, d3

Sign In for Pricing
View Details