Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kars sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7232007 1.0 µg DNA

Kars sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human RGS16 shRNA Plasmid
abx954072-01 150 µg

Human RGS16 shRNA Plasmid

Sign In for Pricing
View Details
Human RGS16 shRNA Plasmid
abx954072-02 300 µg

Human RGS16 shRNA Plasmid

Sign In for Pricing
View Details
MMP3 (Stromelysin-1, SL-1, Matrix Metalloproteinase-3, MMP-3, Transin-1, STMY1, MGC126102, MGC126103, MGC126104) (MaxLight 490)
129763-ML490 100 µL

MMP3 (Stromelysin-1, SL-1, Matrix Metalloproteinase-3, MMP-3, Transin-1, STMY1, MGC126102, MGC126103, MGC126104) (MaxLight 490)

Sign In for Pricing
View Details
PCDH11X Human siRNA Oligo Duplex (Locus ID 27328)
SR309089 1 Kit

PCDH11X Human siRNA Oligo Duplex (Locus ID 27328)

Sign In for Pricing
View Details
SH3 Domain Binding Protein 2 (SH3BP2) Antibody
abx130916 1 mL

SH3 Domain Binding Protein 2 (SH3BP2) Antibody

Sign In for Pricing
View Details