Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBP-tag Antibody
abx134443-01 30 µL

MBP-tag Antibody

Sign In for Pricing
View Details
MBP-tag Antibody
abx134443-02 100 µL

MBP-tag Antibody

Sign In for Pricing
View Details
MBP-tag Antibody
abx134443-03 200 µL

MBP-tag Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SCAMP5 Antibody [PerCP]
NB120-3432PCP 0.1 mL

Rabbit Polyclonal SCAMP5 Antibody [PerCP]

Sign In for Pricing
View Details
OR8B5P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1542906 1.0 µg DNA

OR8B5P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
DPYSL2 (Dihydropyrimidinase-related Protein 2, Collapsin Response Mediator Protein-2, CRMP2, CRMP-2, CRMP 2) (MaxLight 750) discontinued
301345-ML750 100 µL

DPYSL2 (Dihydropyrimidinase-related Protein 2, Collapsin Response Mediator Protein-2, CRMP2, CRMP-2, CRMP 2) (MaxLight 750) discontinued

Sign In for Pricing
View Details