Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD105 (Endoglin, TGF beta1,3 Receptor, gp160) (BSA & Azide Free) (MaxLight 650)
MBS6267861-01 0.1 mL

CD105 (Endoglin, TGF beta1,3 Receptor, gp160) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
CD105 (Endoglin, TGF beta1,3 Receptor, gp160) (BSA & Azide Free) (MaxLight 650)
MBS6267861-02 5x 0.1 mL

CD105 (Endoglin, TGF beta1,3 Receptor, gp160) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Human qPCR Template Standard (NM_002703)
HK205761 1 Kit

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Human qPCR Template Standard (NM_002703)

Sign In for Pricing
View Details
Anti-TRIP Rabbit pAb
GB114626-100 100 μL

Anti-TRIP Rabbit pAb

Sign In for Pricing
View Details
Human MHC I/H-2 II ELISA Kit
EHM0281 96 Tests

Human MHC I/H-2 II ELISA Kit

Sign In for Pricing
View Details
TRA2B (SFRS10, Transformer-2 Protein Homolog beta, Splicing Factor, Arginine/Serine-rich 10, TRA-2 beta, TRA2-beta, hTRA2-beta, Transformer-2 Protein Homolog B, DKFZp686F18120) (FITC)
134660-FITC 100 µL

TRA2B (SFRS10, Transformer-2 Protein Homolog beta, Splicing Factor, Arginine/Serine-rich 10, TRA-2 beta, TRA2-beta, hTRA2-beta, Transformer-2 Protein Homolog B, DKFZp686F18120) (FITC)

Sign In for Pricing
View Details