Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mirabegron Impurity 81
RM-M154307-01 10 mg

Mirabegron Impurity 81

Sign In for Pricing
View Details
Mirabegron Impurity 81
RM-M154307-02 25 mg

Mirabegron Impurity 81

Sign In for Pricing
View Details
Mirabegron Impurity 81
RM-M154307-03 50 mg

Mirabegron Impurity 81

Sign In for Pricing
View Details
Mirabegron Impurity 81
RM-M154307-04 100 mg

Mirabegron Impurity 81

Sign In for Pricing
View Details
Anti Human ITPR2 Pab
272244 100 µg

Anti Human ITPR2 Pab

Sign In for Pricing
View Details
Endotoxin Removal Kit (Polymyxin B)
MBS9719244-01 1 mL

Endotoxin Removal Kit (Polymyxin B)

Sign In for Pricing
View Details