Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

8- Bromo- 7- deaza- cyclic adenosine diphosphate ribose (8-Br-7-CH-cADPR), sodium salt
B 100-025 5x 0.5 µmol

8- Bromo- 7- deaza- cyclic adenosine diphosphate ribose (8-Br-7-CH-cADPR), sodium salt

Sign In for Pricing
View Details
Fa2h sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6296408 1.0 µg DNA

Fa2h sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
ENos, NT (Nitric Oxide Synthase, Endothelial, Endothelial NOS, eNOS, EC-NOS, NOS Type III, NOSIII, Constitutive NOS, cNOS, NOS3)
E3010-86E 200 µL

ENos, NT (Nitric Oxide Synthase, Endothelial, Endothelial NOS, eNOS, EC-NOS, NOS Type III, NOSIII, Constitutive NOS, cNOS, NOS3)

Sign In for Pricing
View Details
FGD3 Blocking Peptide
MBS5400601-01 0.25 mg

FGD3 Blocking Peptide

Sign In for Pricing
View Details
FGD3 Blocking Peptide
MBS5400601-02 5x 0.25 mg

FGD3 Blocking Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal C19orf24 Antibody
NBP1-83638 0.1 mL

Rabbit Polyclonal C19orf24 Antibody

Sign In for Pricing
View Details