Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia Turicatae purA Protein (aa 1-427)
VAng-Lsx2538-1mgEcoli 1 mg (E. coli)

Recombinant Borrelia Turicatae purA Protein (aa 1-427)

Sign In for Pricing
View Details
Human Reelin ELISA Kit (RL)
RK02198 96 Tests

Human Reelin ELISA Kit (RL)

Sign In for Pricing
View Details
Olr1533 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV632051 1.0 µg DNA

Olr1533 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Guinea pig RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (SSU72) ELISA Kit
MBS7244259-01 48 Well

Guinea pig RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (SSU72) ELISA Kit

Sign In for Pricing
View Details
Guinea pig RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (SSU72) ELISA Kit
MBS7244259-02 96 Well

Guinea pig RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (SSU72) ELISA Kit

Sign In for Pricing
View Details
Guinea pig RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (SSU72) ELISA Kit
MBS7244259-03 5x 96 Well

Guinea pig RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (SSU72) ELISA Kit

Sign In for Pricing
View Details