Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS52, CT (VPS52, SACM2L, Vacuolar protein sorting-associated protein 52 homolog, SAC2 suppressor of actin mutations 2-like protein) (FITC) discontinued
043779-FITC 200 µL

VPS52, CT (VPS52, SACM2L, Vacuolar protein sorting-associated protein 52 homolog, SAC2 suppressor of actin mutations 2-like protein) (FITC) discontinued

Sign In for Pricing
View Details
Human ASAH3 (ACER1) activation kit by CRISPRa
GA114904 1 Kit

Human ASAH3 (ACER1) activation kit by CRISPRa

Sign In for Pricing
View Details
Lrrc2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6632007 1.0 µg DNA

Lrrc2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Deschloro-N-des (4-dimethylamino-2-en-1-oxo) butyl Afatinib
446251-01 100 mg

Deschloro-N-des (4-dimethylamino-2-en-1-oxo) butyl Afatinib

Sign In for Pricing
View Details
Deschloro-N-des (4-dimethylamino-2-en-1-oxo) butyl Afatinib
446251-02 1 g

Deschloro-N-des (4-dimethylamino-2-en-1-oxo) butyl Afatinib

Sign In for Pricing
View Details
Dulbecco’s MEM (DMEM) w/o Glucose, Glutamine, Isoleucine, Leucine, Valine, Sodium Pyruvate, Sodium Bicarbonate, Phenol Red (Powder)
D9800-36-01 10 L

Dulbecco’s MEM (DMEM) w/o Glucose, Glutamine, Isoleucine, Leucine, Valine, Sodium Pyruvate, Sodium Bicarbonate, Phenol Red (Powder)

Sign In for Pricing
View Details