Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCTN5 (NM_032486) Human Over-expression Lysate
LH12817V 100 µg

DCTN5 (NM_032486) Human Over-expression Lysate

Sign In for Pricing
View Details
GRASPOS sgRNA CRISPR Lentivector (Human) (Target 2)
K0904303 1.0 µg DNA

GRASPOS sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
DUS2L Antibody
ABF0430 100 µg

DUS2L Antibody

Sign In for Pricing
View Details
Human AP5S1 (NM_018347) AAV Particle
RC208115A1V 250 µL

Human AP5S1 (NM_018347) AAV Particle

Sign In for Pricing
View Details
CD49b (ITGA2) Mouse Monoclonal Antibody [Clone ID: AK7]
SM1125F 100 µg

CD49b (ITGA2) Mouse Monoclonal Antibody [Clone ID: AK7]

Sign In for Pricing
View Details
Snrnp70 Mouse shRNA Plasmid (Locus ID 20637)
TR502093 1 Kit

Snrnp70 Mouse shRNA Plasmid (Locus ID 20637)

Sign In for Pricing
View Details