Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akr1b8 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7358003 1.0 µg DNA

Akr1b8 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Ankrd60 Mouse siRNA Oligo Duplex (Locus ID 70065)
SR410468 1 Kit

Ankrd60 Mouse siRNA Oligo Duplex (Locus ID 70065)

Sign In for Pricing
View Details
Human NTF3 Pre-designed siRNA Set B
SI010869B 1 Each

Human NTF3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
anti-CYP7B1
YF-PA25334 50 ul

anti-CYP7B1

Sign In for Pricing
View Details
Delta 2 Catenin Recombinant Antibody, Cy3 Conjugated
bsm-62833R-Cy3-01 20 µL

Delta 2 Catenin Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Delta 2 Catenin Recombinant Antibody, Cy3 Conjugated
bsm-62833R-Cy3-02 100 µL

Delta 2 Catenin Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details