Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ectoderm-Neural Cortex Protein 1 (ENC1) Antibody
abx431229 200 µL

Ectoderm-Neural Cortex Protein 1 (ENC1) Antibody

Sign In for Pricing
View Details
RCBTB2 (RCC1 and BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, RCC1-like G Exchanging Factor, Regulator of Chromosome Condensation and BTB Domain-containing Protein 2, CHC1L, RLG) (APC)
132427-APC 100 µL

RCBTB2 (RCC1 and BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, RCC1-like G Exchanging Factor, Regulator of Chromosome Condensation and BTB Domain-containing Protein 2, CHC1L, RLG) (APC)

Sign In for Pricing
View Details
Human/Mouse PKC theta Affinity Purified Polyclonal Ab
AF4368-SP 25 µg

Human/Mouse PKC theta Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Sheep Glucokinase ELISA Kit
MBS742505-01 48 Well

Sheep Glucokinase ELISA Kit

Sign In for Pricing
View Details
Sheep Glucokinase ELISA Kit
MBS742505-02 96 Well

Sheep Glucokinase ELISA Kit

Sign In for Pricing
View Details
Sheep Glucokinase ELISA Kit
MBS742505-03 5x 96 Well

Sheep Glucokinase ELISA Kit

Sign In for Pricing
View Details