Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MyD88 Antibody BIOTIN-Conjugated
MBS542150-01 0.1 mg

MyD88 Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
MyD88 Antibody BIOTIN-Conjugated
MBS542150-02 5x 0.1 mg

MyD88 Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
AKR1C1/2 Antibody, mAb, Rabbit
A04260-100 100 µL

AKR1C1/2 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
RGD1306954 Protein Vector (Rat) (pPB-C-His)
PV299350 500 ng

RGD1306954 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Vat1l 3'UTR Luciferase Stable Cell Line
TU121735 1.0 mL

Vat1l 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
C19orf35 Recombinant Protein (Human)
RP049492 100 µg

C19orf35 Recombinant Protein (Human)

Sign In for Pricing
View Details