Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC40A1 (Solute Carrier Family 40 Member 1, Ferroportin-1, Iron-regulated Transporter 1, FPN1, IREG1, SLC11A3, MSTP079) (PE)
133490-PE 100 µL

SLC40A1 (Solute Carrier Family 40 Member 1, Ferroportin-1, Iron-regulated Transporter 1, FPN1, IREG1, SLC11A3, MSTP079) (PE)

Sign In for Pricing
View Details
Bovine HPRT1 ELISA Kit
ELI-38639b 96 Tests

Bovine HPRT1 ELISA Kit

Sign In for Pricing
View Details
Interleukin 10 (IL10) Antibody (RPE)
abx413132-01 100 Tests

Interleukin 10 (IL10) Antibody (RPE)

Sign In for Pricing
View Details
Interleukin 10 (IL10) Antibody (RPE)
abx413132-02 200 µL

Interleukin 10 (IL10) Antibody (RPE)

Sign In for Pricing
View Details
Chicken CHMP2A/Charged multivesicular body protein 2a ELISA Kit
MBS2904299-01 48 Well

Chicken CHMP2A/Charged multivesicular body protein 2a ELISA Kit

Sign In for Pricing
View Details
Chicken CHMP2A/Charged multivesicular body protein 2a ELISA Kit
MBS2904299-02 96 Well

Chicken CHMP2A/Charged multivesicular body protein 2a ELISA Kit

Sign In for Pricing
View Details