Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FER Antibody (C-term) Blocking Peptide
MBS9227183-01 0.5 mg

FER Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
FER Antibody (C-term) Blocking Peptide
MBS9227183-02 5x 0.5 mg

FER Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
FAM119A Antibody
GWB-MS805D 50 µg

FAM119A Antibody

Sign In for Pricing
View Details
SFRP5 3'UTR GFP Stable Cell Line
TU073032 1.0 mL

SFRP5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human Galactolipase / PNLIPRP2 Protein (His tag)
E53A06806 50 µg

Recombinant Human Galactolipase / PNLIPRP2 Protein (His tag)

Sign In for Pricing
View Details
pDsRed-Express-C1 Plasmid
PVT1236 2 µg

pDsRed-Express-C1 Plasmid

Sign In for Pricing
View Details