SPINK1, Human (HEK293, His)
The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
SPINK1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html
Purity
99
Smiles
DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Molecular Formula
6690 (Gene_ID) P00995 (D24-C79) (Accession)
Molecular Weight
Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
CD14, NT (CD14, Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14, urinary form, Monocyte differentiation antigen CD14, membrane-bound form) (MaxLight 650) discontinued
KCNE2, CT (KCNE2, Potassium voltage-gated channel subfamily E member 2, MinK-related peptide 1, Minimum potassium ion channel-related peptide 1, Potassium channel subunit beta MiRP1) (MaxLight 405) discontinued
Canine Alpha-1-Acid Glycoprotein (alpha1-AGP) ELISA Kit
Canine Alpha-1-Acid Glycoprotein (alpha1-AGP) ELISA Kit
Canine Alpha-1-Acid Glycoprotein (alpha1-AGP) ELISA Kit