Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK1, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink1-protein-human-hek-293-his.html

Purity

99

Smiles

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Molecular Formula

6690 (Gene_ID) P00995 (D24-C79) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMPO Polyclonal Antibody
bs-55216R 100 µL

TMPO Polyclonal Antibody

Sign In for Pricing
View Details
AKAP6 Protein Vector (Rat) (pPM-C-HA)
PV252968 500 ng

AKAP6 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
CXORF26 Blocking Peptide
33R-4376 100 ug

CXORF26 Blocking Peptide

Sign In for Pricing
View Details
Solanum tuberosum Agglutunin (STA, potato)
S5328-10 1 mL

Solanum tuberosum Agglutunin (STA, potato)

Sign In for Pricing
View Details
Rat Akt2 Pre-designed siRNA Set A
SI200483A 1 Each

Rat Akt2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CKMT1A, NT (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT) (Biotin)
MBS6470503-01 0.2 mL

CKMT1A, NT (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT) (Biotin)

Sign In for Pricing
View Details