Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bone Morphogenetic Protein 4, BMP4

Recombinant mature human BMP4 is produced in HEK293 cells using stable mammalian expression. This tag-free, liquid-formulated, research-grade protein is purified through a gentle mixed-mode chromatography process designed to preserve its native structure and biological activity. It is suitable for stem cell differentiation, developmental biology, organoid workflows, lineage specification, and media development applications. (Tested applications: Functional studies, ImmunoAssay, Western Blot.)

Product Specifications

Product Name Alternative

Bone Morphogenetic Protein 4, BMP4, BMP-4, BMP2B, BMP-2B, ZYME, DVR4

UniProt

P12644

Expression Region

293-408 aa

Tag

No tag

Origin

Human

Field of Research

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Purity

>95%

Form

Liquid (Sterile-filtered)

Molecular Weight

13 kDa

Storage Conditions

4°C for short-term and -70°/80°C long-term

Notes

For research use only.

Applications Notes

Biologically active and independently validated against human BMP4 from R&D Systems in two differentiation models. 1. In a cardiac differentiation model, Daresbury BMP4 supported beating embryoid body formation and NKX2.5-GFP expression at 11 ng/mL, compared with 25 ng/mL for the commercial reference under the reported conditions. 2. In day-5 trophoblast differentiation of MAN13 hESCs at 10 ng/mL, this product induced CDX2, GATA3, KRT7, and TFAP2A expression by 1540-, 2350-, 7.69-, and 4542-fold, respectively, relative to the untreated control (= 1) . These responses corresponded to approximately 90%, 122%, 88%, and 88% of the R&D Systems reference response, respectively.

Tested Applications

FA, WB

Preservative

20mM histidine pH 5.5, 0.2M NaCl, 0.6M arginine

AA Sequence

SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 3-Bromo-4-fluoro-5-nitrobenzoate
455172-01 100 mg

Methyl 3-Bromo-4-fluoro-5-nitrobenzoate

Sign In for Pricing
View Details
Methyl 3-Bromo-4-fluoro-5-nitrobenzoate
455172-02 250 mg

Methyl 3-Bromo-4-fluoro-5-nitrobenzoate

Sign In for Pricing
View Details
S100A5 Antibody
E55A14631 100 µg

S100A5 Antibody

Sign In for Pricing
View Details
PI4KIIIbeta-IN-9
BA8742-1 1 mg

PI4KIIIbeta-IN-9

Sign In for Pricing
View Details
Mouse Rasgrp2 activation kit by CRISPRa
GA203566 1 Kit

Mouse Rasgrp2 activation kit by CRISPRa

Sign In for Pricing
View Details
CEACAM6 Rabbit mAb
orb1923260-01 20 ul

CEACAM6 Rabbit mAb

Sign In for Pricing
View Details