Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bone Morphogenetic Protein 4, BMP4

Recombinant mature human BMP4 is produced in HEK293 cells using stable mammalian expression. This tag-free, liquid-formulated, research-grade protein is purified through a gentle mixed-mode chromatography process designed to preserve its native structure and biological activity. It is suitable for stem cell differentiation, developmental biology, organoid workflows, lineage specification, and media development applications. (Tested applications: Functional studies, ImmunoAssay, Western Blot.)

Product Specifications

Product Name Alternative

Bone Morphogenetic Protein 4, BMP4, BMP-4, BMP2B, BMP-2B, ZYME, DVR4

UniProt

P12644

Expression Region

293-408 aa

Tag

No tag

Origin

Human

Field of Research

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Purity

>95%

Form

Liquid (Sterile-filtered)

Molecular Weight

13 kDa

Storage Conditions

4°C for short-term and -70°/80°C long-term

Notes

For research use only.

Applications Notes

Biologically active and independently validated against human BMP4 from R&D Systems in two differentiation models. 1. In a cardiac differentiation model, Daresbury BMP4 supported beating embryoid body formation and NKX2.5-GFP expression at 11 ng/mL, compared with 25 ng/mL for the commercial reference under the reported conditions. 2. In day-5 trophoblast differentiation of MAN13 hESCs at 10 ng/mL, this product induced CDX2, GATA3, KRT7, and TFAP2A expression by 1540-, 2350-, 7.69-, and 4542-fold, respectively, relative to the untreated control (= 1) . These responses corresponded to approximately 90%, 122%, 88%, and 88% of the R&D Systems reference response, respectively.

Tested Applications

FA, WB

Preservative

20mM histidine pH 5.5, 0.2M NaCl, 0.6M arginine

AA Sequence

SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AU022751 ORF Vector (Mouse) (pORF)
12859015 1.0 µg DNA

AU022751 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti-Kallikrein 6/KLK6 Antibody Picoband® (Biotine Conjugate)
A01882-2-Biotin 100 µg/Vial

Anti-Kallikrein 6/KLK6 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Lentiviral mouse Gskip shRNA (UAS) - Lentiviral mouse Gskip shRNA (UAS, iRFP) (25)
GTR15127394 1 Vial

Lentiviral mouse Gskip shRNA (UAS) - Lentiviral mouse Gskip shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
LRIG1 HDR Plasmid (m)
sc-421125-HDR 20 µg

LRIG1 HDR Plasmid (m)

Sign In for Pricing
View Details
Recombinant Bovine Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25), partial
MBS7072619 Inquire

Recombinant Bovine Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25), partial

Sign In for Pricing
View Details
ZASC1 Double Nickase Plasmid (h)
sc-417293-NIC 20 µg

ZASC1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details