Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-7 (Il7) (Active)

Product Specifications

Product Name Alternative

IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoietin -1; PBGF

Abbreviation

Recombinant Mouse Il7 protein (Active)

Gene Name

Il7

UniProt

P10168

Expression Region

26-154aa

Organism

Mus musculus (Mouse)

Target Sequence

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Mouse interleukin-7 (IL-7) is the member of hemopoietin family which is important to the differentiation, proliferation, and survival of lymphocyte. Mouse IL-7 shares approximately 88% aa sequence identity with rat IL-7 and 58-60% with human, equine, bovine, ovine, porcine, feline and canine IL-7. It is widely expressed in primary and secondary lymphoid tissues cell and stromal epithelial cells of the thymus, bone marrow, and intestines. IL-7 activation of IL-7 R alpha is critical for both T cell and B cell lineage development. It is important for proliferation during certain stages of B-cell maturation. IL-7 contributes to the maintenance of all naïve and memory T cells, mainly by promoting expression of the anti-apoptotic protein Bcl-2. It is required for optimal T cell-dendritic cell interaction.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 60-1000 pg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EZH1 (NM_001991) Human Recombinant Protein
TP302367L 1 mg

EZH1 (NM_001991) Human Recombinant Protein

Sign In for Pricing
View Details
GDA Rabbit Polyclonal Antibody (Fluoro488)
orb3113374 100 µg

GDA Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
GUK1 Protein Vector (Mouse) (pPM-C-His)
PV187409 500 ng

GUK1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
MAPK1 Rabbit Monoclonal Antibody [Clone ID: 24GB3095]
TA424457S 20 µL

MAPK1 Rabbit Monoclonal Antibody [Clone ID: 24GB3095]

Sign In for Pricing
View Details
Human Glycosylated hemoglobin A1c ELISA Kit
orb1660850 96 Tests

Human Glycosylated hemoglobin A1c ELISA Kit

Sign In for Pricing
View Details
IGLL1 (BC030984) Human Untagged Clone
SC103037 10 µg

IGLL1 (BC030984) Human Untagged Clone

Sign In for Pricing
View Details