Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Astrotactin-1 (ASTN1), partial

Product Specifications

Abbreviation

Recombinant Human ASTN1 protein, partial

Gene Name

ASTN1

UniProt

O14525

Expression Region

22-153aa

Organism

Homo sapiens (Human)

Target Sequence

TAAGDVDPSKELECKLKSITVSALPFLRENDLSIMHSPSASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLFHIHHQDGAPSLPGQDPTEEPQHESAEEELRILH

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Neuronal adhesion molecule that is required for normal migration of young postmitotic neuroblasts along glial fibers, especially in the cerebellum. Required for normal rate of migration of granule cells during brain development and for normal cerebellum development.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Washc1 (NM_001127390) Rat Tagged ORF Clone Lentiviral Particle
RR201376L3V 200 µL

Washc1 (NM_001127390) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Aldosterone Chemiluminescent ELISA Kit
K052-C1 1 Plate

Aldosterone Chemiluminescent ELISA Kit

Sign In for Pricing
View Details
Mouse Hedgehog Homolog, Sonic (SHH) Antibody Pair Kit (with Standard)
MBS2100936-01 5x 96 Tests

Mouse Hedgehog Homolog, Sonic (SHH) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Hedgehog Homolog, Sonic (SHH) Antibody Pair Kit (with Standard)
MBS2100936-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Hedgehog Homolog, Sonic (SHH) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Hedgehog Homolog, Sonic (SHH) Antibody Pair Kit (with Standard)
MBS2100936-03 10x 96 Tests

Mouse Hedgehog Homolog, Sonic (SHH) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Hedgehog Homolog, Sonic (SHH) Antibody Pair Kit (with Standard)
MBS2100936-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Hedgehog Homolog, Sonic (SHH) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details