Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human COL3A1 Protein

Recombinant Human COL3A1 Protein is produced by Komagataella phaffii expression system and the target gene encoding double A908-A1136 is expressed with a 6His tag at the C-terminus.

Product Specifications

Product Name Alternative

Collagen alpha-1 (III) chain

UniProt

P02461

Reactivity

Human

Source

Komagataella phaffii

Endotoxin

Less than 0.05 EU/mg as determined by LAL test.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Form

Liquid

Storage Conditions

Store it at -20°C to -80°C for two years. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Notes

For research use only.

AA Sequence

AGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAHHHHHH

Entrez

1281

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkyne PC NHS 200 nmol scale
26-6753-02 1 Each

Alkyne PC NHS 200 nmol scale

Sign In for Pricing
View Details
ZNF384 Rabbit Polyclonal Antibody (BF405)
orb2465885 100 µL

ZNF384 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Rabbit Monoclonal Carboxypeptidase A2/CPA2 Antibody (30) [mFluor Violet 450 SE]
NBP2-89531MFV450 0.1 mL

Rabbit Monoclonal Carboxypeptidase A2/CPA2 Antibody (30) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
TRNAK15 CRISPR Knock Out 293T Cell Line (Human)
48111141 1x 10^6 Cells / 1.0 mL

TRNAK15 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Anti-FGFRL1 Antibody, Rabbit Polyclonal
MBS8110383-01 0.1 mL

Anti-FGFRL1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-FGFRL1 Antibody, Rabbit Polyclonal
MBS8110383-02 5x 0.1 mL

Anti-FGFRL1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details