Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Human (HEK293)

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. IL-10 Protein, Human (HEK293) is the recombinant human-derived IL-10 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-human-hek293.html

Purity

98.0

Smiles

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Formula

3586 (Gene_ID) P22301 (S19-N178) (Accession)

Molecular Weight

Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FITC anti-human FOXP3
GT09791 25 Tests

FITC anti-human FOXP3

Ask
View Details
CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-sulfotransferase 2, Chondroitin 4-sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, UNQ500/PRO1017)
MBS6008107-01 0.05 mg

CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-sulfotransferase 2, Chondroitin 4-sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, UNQ500/PRO1017)

Ask
View Details
CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-sulfotransferase 2, Chondroitin 4-sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, UNQ500/PRO1017)
MBS6008107-02 5x 0.05 mg

CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-sulfotransferase 2, Chondroitin 4-sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, UNQ500/PRO1017)

Ask
View Details
Recombinant Chicken Neurofibromin (NF1), partial
RPC31442-01 20 µg

Recombinant Chicken Neurofibromin (NF1), partial

Ask
View Details
Recombinant Chicken Neurofibromin (NF1), partial
RPC31442-02 100 µg

Recombinant Chicken Neurofibromin (NF1), partial

Ask
View Details
Recombinant Chicken Neurofibromin (NF1), partial
RPC31442-03 1 mg

Recombinant Chicken Neurofibromin (NF1), partial

Ask
View Details