Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Human (HEK293)

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. IL-10 Protein, Human (HEK293) is the recombinant human-derived IL-10 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-human-hek293.html

Purity

98.0

Smiles

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Formula

3586 (Gene_ID) P22301 (S19-N178) (Accession)

Molecular Weight

Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CCR6 Antibody (53103) [Janelia Fluor 549]
FAB195I 0.1 mL

Mouse Monoclonal CCR6 Antibody (53103) [Janelia Fluor 549]

Sign In for Pricing
View Details
TRNAK36P AAV siRNA Pooled Vector
48133161 1.0 µg

TRNAK36P AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Anti-PPP1CC antibody
PAab06697 100 µg

Anti-PPP1CC antibody

Sign In for Pricing
View Details
GRP ORF Vector (Human) (pORF)
ORF004687 1.0 µg DNA

GRP ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Quick Step Rat reactive oxygen species (ROS) elisa Kit
QS1189Ra-01 48 Tests

Quick Step Rat reactive oxygen species (ROS) elisa Kit

Sign In for Pricing
View Details
Quick Step Rat reactive oxygen species (ROS) elisa Kit
QS1189Ra-02 96 Tests

Quick Step Rat reactive oxygen species (ROS) elisa Kit

Sign In for Pricing
View Details