Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Human (HEK293)

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. IL-10 Protein, Human (HEK293) is the recombinant human-derived IL-10 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-human-hek293.html

Purity

98.0

Smiles

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Formula

3586 (Gene_ID) P22301 (S19-N178) (Accession)

Molecular Weight

Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYSF Antibody
MBS7120968-01 0.05 mg

DYSF Antibody

Sign In for Pricing
View Details
DYSF Antibody
MBS7120968-02 0.1 mg

DYSF Antibody

Sign In for Pricing
View Details
DYSF Antibody
MBS7120968-03 5x 0.1 mg

DYSF Antibody

Sign In for Pricing
View Details
RPL28 AAV Vector (Rat) (CMV)
41290106 1 µg

RPL28 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Hist1h3d ORF Vector (Mouse) (pORF)
ORF047217 1.0 µg DNA

Hist1h3d ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rat rno-miR-147 miRNA Antagomir
abx890035-01 10 nmol

Rat rno-miR-147 miRNA Antagomir

Sign In for Pricing
View Details