Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Human (HEK293)

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. IL-10 Protein, Human (HEK293) is the recombinant human-derived IL-10 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-human-hek293.html

Purity

98.0

Smiles

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Formula

3586 (Gene_ID) P22301 (S19-N178) (Accession)

Molecular Weight

Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Wdr73 Rat shRNA Plasmid (Locus ID 308751)
TR706079 1 Kit

Wdr73 Rat shRNA Plasmid (Locus ID 308751)

Ask
View Details
LSM1 (U6 snRNA-associated Sm-like Protein LSm1, Cancer-associated Sm-like, Small Nuclear Ribonuclear CaSm, CASM) (APC)
129236-APC 100 µL

LSM1 (U6 snRNA-associated Sm-like Protein LSm1, Cancer-associated Sm-like, Small Nuclear Ribonuclear CaSm, CASM) (APC)

Ask
View Details
Serine Racemase (SRR) BioAssayTM ELISA Kit (Mouse)
589746 96 Tests

Serine Racemase (SRR) BioAssayTM ELISA Kit (Mouse)

Ask
View Details
Abhd18 Mouse Gene Knockout Kit (CRISPR)
KN500316 1 Kit

Abhd18 Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
ZNF307 (Zinc Finger Protein 307, Zinc Finger Protein 427, ZNF427, Zinc Finger Protein with KRAB and SCAN Domains 4, ZKSCAN4, P373c6.1) (MaxLight 650)
MBS6225555-01 0.1 mL

ZNF307 (Zinc Finger Protein 307, Zinc Finger Protein 427, ZNF427, Zinc Finger Protein with KRAB and SCAN Domains 4, ZKSCAN4, P373c6.1) (MaxLight 650)

Ask
View Details
ZNF307 (Zinc Finger Protein 307, Zinc Finger Protein 427, ZNF427, Zinc Finger Protein with KRAB and SCAN Domains 4, ZKSCAN4, P373c6.1) (MaxLight 650)
MBS6225555-02 5x 0.1 mL

ZNF307 (Zinc Finger Protein 307, Zinc Finger Protein 427, ZNF427, Zinc Finger Protein with KRAB and SCAN Domains 4, ZKSCAN4, P373c6.1) (MaxLight 650)

Ask
View Details