Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Human (HEK293)

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. IL-10 Protein, Human (HEK293) is the recombinant human-derived IL-10 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-human-hek293.html

Purity

98.0

Smiles

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Formula

3586 (Gene_ID) P22301 (S19-N178) (Accession)

Molecular Weight

Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LRRN1 (Leucine Rich Repeat Neuronal 1, FIGLER3, KIAA1497, NLRR-1, LRCH4) (MaxLight 650)
MBS6228569-01 0.1 mL

LRRN1 (Leucine Rich Repeat Neuronal 1, FIGLER3, KIAA1497, NLRR-1, LRCH4) (MaxLight 650)

Ask
View Details
LRRN1 (Leucine Rich Repeat Neuronal 1, FIGLER3, KIAA1497, NLRR-1, LRCH4) (MaxLight 650)
MBS6228569-02 5x 0.1 mL

LRRN1 (Leucine Rich Repeat Neuronal 1, FIGLER3, KIAA1497, NLRR-1, LRCH4) (MaxLight 650)

Ask
View Details
Betaine Activity Assay Kit
AK0151-50T-48S 50 Tests - 48 Samples

Betaine Activity Assay Kit

Ask
View Details
Treponema pallidum
bsm-72441M 100 µg

Treponema pallidum

Ask
View Details
Human Hepatitis B core antigen - Antibody - IgM (HBcAb-IgM) ELISA kit
YLA3823HU-01 48 Tests

Human Hepatitis B core antigen - Antibody - IgM (HBcAb-IgM) ELISA kit

Ask
View Details
Human Hepatitis B core antigen - Antibody - IgM (HBcAb-IgM) ELISA kit
YLA3823HU-02 96 Tests

Human Hepatitis B core antigen - Antibody - IgM (HBcAb-IgM) ELISA kit

Ask
View Details