Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Beta-2-microglobulin (B2M)

Recombinant Cat Beta-2-microglobulin (B2M)

Product Specifications

Product Name Alternative

B2M

UniProt

Q5MGS7

Expression Region

21-118aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation; Metabolism Research

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VQHSPKVQVYSRHPAENGKPNFLNCYVSGFHPPQIDITLMKNGKKMEAEQTDLSFNRDWTFYLLVHTEFTPTVEDEYSCQVNHTTLSEPKVVKWDRDM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bitolterol discontinued. See 162911
263588-01 5 mg

Bitolterol discontinued. See 162911

Sign In for Pricing
View Details
Bitolterol discontinued. See 162911
263588-02 10 mg

Bitolterol discontinued. See 162911

Sign In for Pricing
View Details
Bitolterol discontinued. See 162911
263588-03 25 mg

Bitolterol discontinued. See 162911

Sign In for Pricing
View Details
Bitolterol discontinued. See 162911
263588-04 50 mg

Bitolterol discontinued. See 162911

Sign In for Pricing
View Details
Bitolterol discontinued. See 162911
263588-05 100 mg

Bitolterol discontinued. See 162911

Sign In for Pricing
View Details
FNDC3B (Fibronectin Type III Domain-containing Protein 3B, Factor for Adipocyte Differentiation 104, HCV NS5A-binding Protein 37, FAD104, NS5ABP37, UNQ2421/PRO4979/PRO34274, DKFZp686D14170, DKFZp762K137, FLJ23399, YVTM2421) (MaxLight 550)
137980-ML550 100 µL

FNDC3B (Fibronectin Type III Domain-containing Protein 3B, Factor for Adipocyte Differentiation 104, HCV NS5A-binding Protein 37, FAD104, NS5ABP37, UNQ2421/PRO4979/PRO34274, DKFZp686D14170, DKFZp762K137, FLJ23399, YVTM2421) (MaxLight 550)

Sign In for Pricing
View Details