Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly6/PLAUR domain-containing protein 1 (LYPD1)

Recombinant Human Ly6/PLAUR domain-containing protein 1 (LYPD1)

Product Specifications

Product Name Alternative

Putative HeLa tumor suppressor

UniProt

Q8N2G4

Expression Region

21-117aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1579 Rat siRNA Oligo Duplex (Locus ID 289239)
SR508285 1 Kit

Olr1579 Rat siRNA Oligo Duplex (Locus ID 289239)

Sign In for Pricing
View Details
SLC25A6P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV748580 1.0 µg DNA

SLC25A6P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
SLC12A3 Antibody - middle region
ARP43742_P050-25UL 25 µL

SLC12A3 Antibody - middle region

Sign In for Pricing
View Details
Mouse Neurofilament, Light Polypeptide (NEFL) ELISA Kit
EKU06216 96 Tests

Mouse Neurofilament, Light Polypeptide (NEFL) ELISA Kit

Sign In for Pricing
View Details
CILP ORF Vector (Human) (pORF)
ORF002382 1.0 µg DNA

CILP ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CYP4B1, ID (Cytochrome P450 4B1, CYPIVB1, Cytochrome P450-HP) (MaxLight 490)
MBS6471707-01 0.1 mL

CYP4B1, ID (Cytochrome P450 4B1, CYPIVB1, Cytochrome P450-HP) (MaxLight 490)

Sign In for Pricing
View Details