Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-cell differentiation antigen CD72 (CD72), partial

Recombinant Human B-cell differentiation antigen CD72 (CD72), partial

Product Specifications

Product Name Alternative

Lyb-2

UniProt

P21854

Expression Region

117-359aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TREH Protein Vector (Rat) (pPM-C-His)
PV312785 500 ng

TREH Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Oct4
E8RE6048 100 µL

Oct4

Sign In for Pricing
View Details
Ethyl 3-chloro-2-fluoro-5-formylbenzoate
PC1016193-01 250 mg

Ethyl 3-chloro-2-fluoro-5-formylbenzoate

Sign In for Pricing
View Details
Ethyl 3-chloro-2-fluoro-5-formylbenzoate
PC1016193-02 500 mg

Ethyl 3-chloro-2-fluoro-5-formylbenzoate

Sign In for Pricing
View Details
IL18R1 Protein (C-His, Rat)
P521233 100 µg

IL18R1 Protein (C-His, Rat)

Sign In for Pricing
View Details
Human Cardiolipin (CL) ELISA Kit
orb1946840-01 48 Tests

Human Cardiolipin (CL) ELISA Kit

Sign In for Pricing
View Details