Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Beta-defensin 5 (DEFB5)

Recombinant Bovine Beta-defensin 5 (DEFB5)

Product Specifications

Product Name Alternative

BNBD-5; BNDB-5

UniProt

P46163

Expression Region

23-64aa

Tag

C-terminal GST-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.239.

AA Sequence

QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP1B1 (NM_001127) Human Over-expression Lysate
LC420112 20 µg

AP1B1 (NM_001127) Human Over-expression Lysate

Sign In for Pricing
View Details
2-(Benzyloxy)phenol
TRC-B286655-5G 5 g

2-(Benzyloxy)phenol

Sign In for Pricing
View Details
Gelsolin / Actin-depolymerizing Factor (CPTC-Gelsolin-1), CF568 conjugate, 0.1mg/mL
BNC682239-500 1x 500 µL

Gelsolin / Actin-depolymerizing Factor (CPTC-Gelsolin-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
14-3-3 Sigma / Stratifin (CPTC-SFN-2), CF568 conjugate, 0.1mg/mL
BNC682481-500 1x 500 µL

14-3-3 Sigma / Stratifin (CPTC-SFN-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAR1L (NM_001136571) Human Over-expression Lysate
LC427927 20 µg

ZAR1L (NM_001136571) Human Over-expression Lysate

Sign In for Pricing
View Details
KRTHA3B (KRT33B) (NM_002279) Human Over-expression Lysate
LC419431 20 µg

KRTHA3B (KRT33B) (NM_002279) Human Over-expression Lysate

Sign In for Pricing
View Details