Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Beta-defensin 5 (DEFB5)

Recombinant Bovine Beta-defensin 5 (DEFB5)

Product Specifications

Product Name Alternative

BNBD-5; BNDB-5

UniProt

P46163

Expression Region

23-64aa

Tag

C-terminal GST-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.239.

AA Sequence

QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRAK2 (STK17B) (NM_004226) Human Over-expression Lysate
LC401355 20 µg

DRAK2 (STK17B) (NM_004226) Human Over-expression Lysate

Sign In for Pricing
View Details
IL20 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H7]
TA803410BM 100 µL

IL20 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H7]

Sign In for Pricing
View Details
Mohawk homeobox (MKX) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H10]
TA808350BM 100 µL

Mohawk homeobox (MKX) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H10]

Sign In for Pricing
View Details
RBMY1D Rabbit Polyclonal Antibody
TA368734 100 µL

RBMY1D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702023 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Phenformin Hydrochloride
TRC-P296900-5G 5 g

Phenformin Hydrochloride

Sign In for Pricing
View Details