Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Beta-defensin 5 (DEFB5)

Recombinant Bovine Beta-defensin 5 (DEFB5)

Product Specifications

Product Name Alternative

BNBD-5; BNDB-5

UniProt

P46163

Expression Region

23-64aa

Tag

C-terminal GST-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.239.

AA Sequence

QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF836 Human Gene Knockout Kit (CRISPR)
KN419112 1 Kit

ZNF836 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-(2-Amino-4,6-dichloro-5-pyrimidinyl)formamide
TRC-A604735-25G 25 g

N-(2-Amino-4,6-dichloro-5-pyrimidinyl)formamide

Sign In for Pricing
View Details
IFluor® 790 acid
1360-AAT 5 mg

IFluor® 790 acid

Sign In for Pricing
View Details
T7 Goat Polyclonal Antibody
AB0126-100 300 µg

T7 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1718), CF488A conjugate, 0.1mg/mL
BNC882498-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1718), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C2orf43 (LDAH) (NM_001282719) Human Tagged ORF Clone
RG237167 10 µg

C2orf43 (LDAH) (NM_001282719) Human Tagged ORF Clone

Sign In for Pricing
View Details