Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free DCIP-1/CXCL3, Mouse (His)

DCIP-1/CXCL3 Protein, a CXCR2 ligand, exhibits chemotactic activity for neutrophils, implicating its role in inflammation. It may autonomously affect endothelial cells. The protein's chemotactic activity implies a potential regulatory role in recruiting and activating neutrophils in response to inflammatory stimuli. Animal-Free DCIP-1/CXCL3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeDCIP-1/CXCL3 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free DCIP-1/CXCL3 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-dcip-1-cxcl3-protein-mouse-his.html

Purity

98.00

Smiles

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Molecular Formula

330122 (Gene_ID) Q6W5C0 (A28-S100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-500 1x 500 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-500 1x 500 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details