Animal-Free DCIP-1/CXCL3, Mouse (His)
DCIP-1/CXCL3 Protein, a CXCR2 ligand, exhibits chemotactic activity for neutrophils, implicating its role in inflammation. It may autonomously affect endothelial cells. The protein's chemotactic activity implies a potential regulatory role in recruiting and activating neutrophils in response to inflammatory stimuli. Animal-Free DCIP-1/CXCL3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeDCIP-1/CXCL3 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free DCIP-1/CXCL3 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-dcip-1-cxcl3-protein-mouse-his.html
Purity
98.00
Smiles
AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
Molecular Formula
330122 (Gene_ID) Q6W5C0 (A28-S100) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL
