Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Natriuretic peptides B (Nppb), partial

Recombinant Rat Natriuretic peptides B (Nppb), partial

Product Specifications

Product Name Alternative

Brain natriuretic factor prohormone; Gamma-brain natriuretic peptide; Iso-ANP

UniProt

P13205

Expression Region

77-121aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.237.

AA Sequence

SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG4, NT (ABCG4, WHITE2, ATP-binding cassette sub-family G member 4) (PE) discontinued
031488-PE 200 µL

ABCG4, NT (ABCG4, WHITE2, ATP-binding cassette sub-family G member 4) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Human TSR3 Protein
E30P65014A 50 µg

Recombinant Human TSR3 Protein

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces Pombe SPAC343.17c Protein (aa 1-576)
VAng-Yyj6438-inquire Inquire

Recombinant Schizosaccharomyces Pombe SPAC343.17c Protein (aa 1-576)

Sign In for Pricing
View Details
Rabbit Polyclonal SLC29A4 Antibody
NBP2-41314 0.1 mg

Rabbit Polyclonal SLC29A4 Antibody

Sign In for Pricing
View Details
SEC (C165) Alexa Fluor® 647
sc-73353 AF647 200 µg/mL

SEC (C165) Alexa Fluor® 647

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis serovar E Deubiquitinase and deneddylase Dub1 (cdu1)
MBS7011259-01 0.02 mg

Recombinant Chlamydia trachomatis serovar E Deubiquitinase and deneddylase Dub1 (cdu1)

Sign In for Pricing
View Details