Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (HEK293)

SCF Protein, Rat (HEK293) is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis.

Product Specifications

Product Name Alternative

SCF Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-hek293.html

Purity

95.00

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 10-24 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Farhadi B, et al. Construction of pPIC9 Recombinant Vector Containing Human Stem Cell Factor. Adv Pharm Bull. 2013;3 (2) :303-8.|[2]Kim JY, et al. Stem cell factor is a potent endothelial permeability factor. Arterioscler Thromb Vasc Biol. 2014 Jul;34 (7) :1459-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAT1 (ACACA) (NM_198834) Human Tagged Lenti ORF Clone
RC218293L1 10 µg

ACAT1 (ACACA) (NM_198834) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HLA-DPB1 (NM_002121) Human Over-expression Lysate
LH19576V 100 µg

HLA-DPB1 (NM_002121) Human Over-expression Lysate

Sign In for Pricing
View Details
MYO1E Antibody - middle region : HRP (ARP56601_P050-HRP)
ARP56601_P050-HRP 100 µL

MYO1E Antibody - middle region : HRP (ARP56601_P050-HRP)

Sign In for Pricing
View Details
GTSE1 Antibody
E043680 100 µg -100 µL

GTSE1 Antibody

Sign In for Pricing
View Details
TRNAP20-set siRNA/shRNA/RNAi Lentivector (Human)
48262091 4x 500 ng

TRNAP20-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Troxipide
HY-B0758-01 250 mg

Troxipide

Sign In for Pricing
View Details