Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Creatine kinase M-type/CKM, Human (HEK293, His)

KCRM is a cytoplasmic creatine kinase isoenzyme responsible for participating in energy transduction and maintaining energy homeostasis. KCRM reversibly catalyzes phosphate transfer between ATP and various phosphogens (e.g., creatine phosphate) and is an important serum marker of myocardial infarction. Creatine kinase M-type/CKM Protein, Human (HEK293, His) is the recombinant human-derived Creatine kinase M-type/CKM protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Creatine kinase M-type/CKM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/creatine-kinase-m-type-protein-human-hek-293-his.html

Purity

98.0

Smiles

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Molecular Formula

1158 (Gene_ID) AAP35439.1 (M1-K381) (Accession)

Molecular Weight

Approximately 46.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-100 1x 100 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-500 1x 500 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF640R conjugate, 0.1mg/mL
BNC402685-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DRA) (19-26.1), CF647 conjugate, 0.1mg/mL
BNC471082-500 1x 500 µL

MHC II (HLA-DRA) (19-26.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details