Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Creatine kinase M-type/CKM, Human (HEK293, His)

KCRM is a cytoplasmic creatine kinase isoenzyme responsible for participating in energy transduction and maintaining energy homeostasis. KCRM reversibly catalyzes phosphate transfer between ATP and various phosphogens (e.g., creatine phosphate) and is an important serum marker of myocardial infarction. Creatine kinase M-type/CKM Protein, Human (HEK293, His) is the recombinant human-derived Creatine kinase M-type/CKM protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Creatine kinase M-type/CKM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/creatine-kinase-m-type-protein-human-hek-293-his.html

Purity

98.0

Smiles

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Molecular Formula

1158 (Gene_ID) AAP35439.1 (M1-K381) (Accession)

Molecular Weight

Approximately 46.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ifltd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3169405 3x 1.0 µg

Ifltd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
MED19 Antibody - middle region : FITC (ARP55596_P050-FITC)
ARP55596_P050-FITC 100 µL

MED19 Antibody - middle region : FITC (ARP55596_P050-FITC)

Sign In for Pricing
View Details
Mmu-let-7c-2-3p miRNA Mimic
CMM0555-01 5 nmol

Mmu-let-7c-2-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-let-7c-2-3p miRNA Mimic
CMM0555-02 10 nmol

Mmu-let-7c-2-3p miRNA Mimic

Sign In for Pricing
View Details
YME1L1 Protein Lysate
OCOA06323-20UG 20 µg

YME1L1 Protein Lysate

Sign In for Pricing
View Details
Rp2h 3'UTR GFP Stable Cell Line
TU168050 1.0 mL

Rp2h 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details