Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL24/Eotaxin-2, Mouse

CCL24/Eotaxin-2 Protein, Mouse is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by E. coli[1].

Product Specifications

Product Name Alternative

CCL24/Eotaxin-2 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl24-eotaxin-2-protein-mouse.html

Purity

95.0

Smiles

VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV

Molecular Formula

56221 (Gene_ID) Q9JKC0 (V27-V119) (Accession)

Molecular Weight

Approximately 12 kDa

References & Citations

[1] Amanda K Huber, et al. An emerging role for eotaxins in neurodegenerative disease. Clin Immunol. 2018 Apr;189:29-33.|[2]Adi Mor. et al. Blockade of CCL24 with a monoclonal antibody ameliorates experimental dermal and pulmonary fibrosis. Ann Rheum Dis. 2019 Sep;78 (9) :1260-1268.|[3]Hui Li, et al. Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy. Int J Clin Exp Pathol. 2013 May 15;6 (6) :1028-37.|[4]Michal Segal-Salto, et al. A blocking monoclonal antibody to CCL24 alleviates liver fibrosis and inflammation in experimental models of liver damage. JHEP Rep. 2020 Jan 2;2 (1) :100064.|[5]Adi Mor, et al. Blockade of CCL24 with a monoclonal antibody ameliorates experimental dermal and pulmonary fibrosis. Ann Rheum Dis. 2019 Sep;78 (9) :1260-1268.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-methionine gamma-lyase
CZM1116-01 100 U

L-methionine gamma-lyase

Sign In for Pricing
View Details
L-methionine gamma-lyase
CZM1116-02 500 U

L-methionine gamma-lyase

Sign In for Pricing
View Details
L-methionine gamma-lyase
CZM1116-03 5 KU

L-methionine gamma-lyase

Sign In for Pricing
View Details
Serpinb9c (NM_011453) Mouse Tagged ORF Clone
MR204990 10 µg

Serpinb9c (NM_011453) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mfap1b CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
28433154 3x 1.0 µg DNA

Mfap1b CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
ZCCHC3 Human shRNA Plasmid Kit (Locus ID 85364)
TR317674 1 Kit

ZCCHC3 Human shRNA Plasmid Kit (Locus ID 85364)

Sign In for Pricing
View Details