Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High mobility group protein B1 (HMGB1), partial

Product Specifications

Product Name Alternative

High mobility group protein 1 ; HMG-1

Abbreviation

Recombinant Human HMGB1 protein, partial

Gene Name

HMGB1

UniProt

P09429

Expression Region

2-67aa

Organism

Homo sapiens (Human)

Target Sequence

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKAD

Tag

N-terminal hFc-Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Epigenetics and Nuclear Signaling

Relevance

DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V (D) J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS) . Heparin-binding protein that has a role in the extension of neurite-type Cytoplasmic domain processes in developing cells .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSG (NM_014960) Human Over-expression Lysate
LC402396 20 µg

ARSG (NM_014960) Human Over-expression Lysate

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), 0.2mg/mL
BNUB2408-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), 0.2mg/mL

Sign In for Pricing
View Details
Human CD11b (ITGAM) activation kit by CRISPRa
GA102474 1 Kit

Human CD11b (ITGAM) activation kit by CRISPRa

Sign In for Pricing
View Details
Thrombospondin 1 (THBS1) (NM_003246) Human Over-expression Lysate
LY401119 100 µg

Thrombospondin 1 (THBS1) (NM_003246) Human Over-expression Lysate

Sign In for Pricing
View Details
VMA21 (NM_001017980) Human Recombinant Protein
TP311043 20 µg

VMA21 (NM_001017980) Human Recombinant Protein

Sign In for Pricing
View Details
O-Benzyl Psilocin
TRC-B288710-10MG 10 mg

O-Benzyl Psilocin

Sign In for Pricing
View Details