Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High mobility group protein B1 (HMGB1), partial

Product Specifications

Product Name Alternative

High mobility group protein 1 ; HMG-1

Abbreviation

Recombinant Human HMGB1 protein, partial

Gene Name

HMGB1

UniProt

P09429

Expression Region

2-67aa

Organism

Homo sapiens (Human)

Target Sequence

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKAD

Tag

N-terminal hFc-Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Epigenetics and Nuclear Signaling

Relevance

DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V (D) J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS) . Heparin-binding protein that has a role in the extension of neurite-type Cytoplasmic domain processes in developing cells .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OLFM4 activation kit by CRISPRa
GA107222 1 Kit

Human OLFM4 activation kit by CRISPRa

Sign In for Pricing
View Details
Importin 13 (IPO13) (NM_014652) Human Over-expression Lysate
LY402359 100 µg

Importin 13 (IPO13) (NM_014652) Human Over-expression Lysate

Sign In for Pricing
View Details
KLF5 Mouse Monoclonal Antibody [Clone ID: OTI2G4]
CF811879 100 µg

KLF5 Mouse Monoclonal Antibody [Clone ID: OTI2G4]

Sign In for Pricing
View Details
6-Benzyloxy-1-cyclopropyl-1,4-dihydro-7-fluoro-4-oxo-3-quinolinecarboxylic Acid Benzyl Ester
TRC-B287985-25MG 25 mg

6-Benzyloxy-1-cyclopropyl-1,4-dihydro-7-fluoro-4-oxo-3-quinolinecarboxylic Acid Benzyl Ester

Sign In for Pricing
View Details
AFViolet 450 Rat IgG2b, κ Isotype Control
RD30073F-01 25 µg

AFViolet 450 Rat IgG2b, κ Isotype Control

Sign In for Pricing
View Details
AFViolet 450 Rat IgG2b, κ Isotype Control
RD30073F-02 100 µg

AFViolet 450 Rat IgG2b, κ Isotype Control

Sign In for Pricing
View Details