Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-D, Mouse (HEK293, Fc)

VEGF-D Protein, a versatile growth factor, orchestrates angiogenesis, lymphangiogenesis, and endothelial cell growth. It stimulates proliferation, migration, and influences vessel permeability. VEGF-D binds VEGFR-3, triggering crucial signaling for vascular development. Structurally, VEGF-D is a non-covalent homodimer, emphasizing its intricate role in vascular processes. VEGF-D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived VEGF-D protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

VEGF-D Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-d-protein-mouse-hek293-fc.html

Purity

96.00

Smiles

FYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYS

Molecular Formula

14205 (Gene_ID) P97946 (F98-S206) (Accession)

Molecular Weight

Approximately 45 kDa & 36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF647 conjugate, 0.1mg/mL
BNC470032-100 1x 100 µL

MUC2 (CCP58), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26), CF555 conjugate, 0.1mg/mL
BNC550020-500 1x 500 µL

Cytokeratin 19 (A53-B/A2.26), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details