Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCN2B, Human (HEK293, His)

SCN2B protein is a key subunit of voltage-gated sodium channels and plays an important role in regulating channel function by interacting with the pore-forming α subunit. This interaction regulates the flux of sodium ions across the cell membrane, affecting neuronal excitability and action potential propagation. SCN2B Protein, Human (HEK293, His) is the recombinant human-derived SCN2B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SCN2B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scn2b-protein-human-hek293-his.html

Purity

95.00

Smiles

MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVA

Molecular Formula

6327 (Gene_ID) O60939 (M30-A159) (Accession)

Molecular Weight

Approximately 21-34 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL
BNC880669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-100 1x 100 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF488A conjugate, 0.1mg/mL
BNC880264-500 1x 500 µL

Human Kappa Light Chain (KLC264), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), CF640R conjugate, 0.1mg/mL
BNC400417-500 1x 500 µL

Fascin-1 (FSCN1/417), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details