Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCN2B, Human (HEK293, His)

SCN2B protein is a key subunit of voltage-gated sodium channels and plays an important role in regulating channel function by interacting with the pore-forming α subunit. This interaction regulates the flux of sodium ions across the cell membrane, affecting neuronal excitability and action potential propagation. SCN2B Protein, Human (HEK293, His) is the recombinant human-derived SCN2B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SCN2B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scn2b-protein-human-hek293-his.html

Purity

95.00

Smiles

MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVA

Molecular Formula

6327 (Gene_ID) O60939 (M30-A159) (Accession)

Molecular Weight

Approximately 21-34 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Hydroxyirisquinone
T83356-01 5 mg

3-Hydroxyirisquinone

Sign In for Pricing
View Details
3-Hydroxyirisquinone
T83356-02 50 mg

3-Hydroxyirisquinone

Sign In for Pricing
View Details
TRIM5 Polyclonal Antibody
E91872 100 µL

TRIM5 Polyclonal Antibody

Sign In for Pricing
View Details
Thymidine Kinase 1 (pS13) Antibody
MBS8583551-01 0.1 mL

Thymidine Kinase 1 (pS13) Antibody

Sign In for Pricing
View Details
Thymidine Kinase 1 (pS13) Antibody
MBS8583551-02 0.1 mL (AF635)

Thymidine Kinase 1 (pS13) Antibody

Sign In for Pricing
View Details
Thymidine Kinase 1 (pS13) Antibody
MBS8583551-03 0.1 mL (AF610)

Thymidine Kinase 1 (pS13) Antibody

Sign In for Pricing
View Details