Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)

Product Specifications

Product Name Alternative

ATP-dependent inwardly rectifying potassium channel Kir4.1 Inward rectifier K (+) channel Kir1.2 Potassium channel, inwardly rectifying subfamily J member 10

Abbreviation

Recombinant Human KCNJ10 protein

Gene Name

KCNJ10

UniProt

P78508

Expression Region

1-379aa

Organism

Homo sapiens (Human)

Target Sequence

MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Neuroscience

Relevance

May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. In the kidney, together with KCNJ16, mediates basolateral K+ recycling in distal tubules; this process is critical for Na+ reabsorption at the tubules

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.6 kDa

References & Citations

"Co-expression of human Kir3 subunits can yield channels with different functional properties."Schoots O., Wilson J.M., Ethier N., Bigras E., Hebert T.E., Van Tol H.H.M.Cell. Signal. 11:871-883 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Olfr1 (NM_146921) Mouse Tagged ORF Clone Lentiviral Particle
MR219538L3V 200 µL

Olfr1 (NM_146921) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Human Monoclonal OX40 Ligand/TNFSF4 Antibody (R4930 (Oxelumab)) [DyLight 405]
NBP2-75913V 0.1 mL

Human Monoclonal OX40 Ligand/TNFSF4 Antibody (R4930 (Oxelumab)) [DyLight 405]

Ask
View Details
Human Suppression Of Tumorigenicity 14 Protein (ST14) ELISA Kit
JL17758-01 48 Tests

Human Suppression Of Tumorigenicity 14 Protein (ST14) ELISA Kit

Ask
View Details
Human Suppression Of Tumorigenicity 14 Protein (ST14) ELISA Kit
JL17758-02 96 Tests

Human Suppression Of Tumorigenicity 14 Protein (ST14) ELISA Kit

Ask
View Details
beta 3 Adrenergic Receptor (ADRB3) (NM_000025) Human Untagged Clone
SC117219 10 µg

beta 3 Adrenergic Receptor (ADRB3) (NM_000025) Human Untagged Clone

Ask
View Details
HMAM5 Cells
T8099 1x106 cells / 1.0 mL

HMAM5 Cells

Ask
View Details