Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans CSA2 Protein, C-His

Recombinant Candida albicans CSA2 Protein, C-His

Product Specifications

Tag

His-tag

Storage Conditions

Use a manual defrost freezer and avoid repeated freeze thaw cycles. Store at 2 to 8°C for frequent use. Store at -20 to -80°C for twelve months from the date of receipt.

Notes

For research use only.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGHV3-D Protein Lysate (Human) with C-Ha Tag
24479031 100 µg

IGHV3-D Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
pC0072  LbuCas13a His6-TwinStrep-SUMO-BsaI Plasmid
PVT36060 2 µg

pC0072 LbuCas13a His6-TwinStrep-SUMO-BsaI Plasmid

Sign In for Pricing
View Details
FGF6 Rabbit pAb, IRDye 800CW conjugated
orb2856270 100 µL

FGF6 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
CX001, CT (CXorf1, Uncharacterized protein CXorf1) (FITC) discontinued
034376-FITC 200 µL

CX001, CT (CXorf1, Uncharacterized protein CXorf1) (FITC) discontinued

Sign In for Pricing
View Details
H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
PH00215-01 1 mg

H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2

Sign In for Pricing
View Details
H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
PH00215-02 10 mg

H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2

Sign In for Pricing
View Details