Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interleukin 17A (IL17A)

Recombinant Macaca mulatta Interleukin 17A (IL17A)

Product Specifications

UniProt

F6T3G5

Expression Region

24-155aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FXYD6 activation kit by CRISPRa
GA110024 1 Kit

Human FXYD6 activation kit by CRISPRa

Sign In for Pricing
View Details
NKAPD1 (NM_001082970) Human Over-expression Lysate
LY421201 100 µg

NKAPD1 (NM_001082970) Human Over-expression Lysate

Sign In for Pricing
View Details
Nuclear Factor Erythroid Derived 2 (NFE2) (NM_001136023) Human Over-expression Lysate
LC427772 20 µg

Nuclear Factor Erythroid Derived 2 (NFE2) (NM_001136023) Human Over-expression Lysate

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF594 conjugate, 0.1mg/mL
BNC941372-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ezrin (EZR) Rabbit Polyclonal Antibody
AP06112PU-N 100 µg

Ezrin (EZR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HS6ST2 Antibody
OC-2394-01 50 μL

HS6ST2 Antibody

Sign In for Pricing
View Details