Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interleukin 17A (IL17A)

Recombinant Macaca mulatta Interleukin 17A (IL17A)

Product Specifications

UniProt

F6T3G5

Expression Region

24-155aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubd1 Mouse Gene Knockout Kit (CRISPR)
KN518474 1 Kit

Tubd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FRMD6 (NM_001042481) Human Over-expression Lysate
LY420934 100 µg

FRMD6 (NM_001042481) Human Over-expression Lysate

Sign In for Pricing
View Details
Ataxin 3 (ATXN3) Goat Polyclonal Antibody
AB10089-500 1.5 mg

Ataxin 3 (ATXN3) Goat Polyclonal Antibody

Sign In for Pricing
View Details
2-Chloroindole
TRC-C364270-250MG 250 mg

2-Chloroindole

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF594 conjugate, 0.1mg/mL
BNC942341-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Isatuximab Biosimilar - Research Grade
ICH5028-20mg 20 mg

Isatuximab Biosimilar - Research Grade

Sign In for Pricing
View Details