Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29), partial

Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29), partial

Product Specifications

Product Name Alternative

Endoplasmic reticulum resident protein 28 ; ERp28Endoplasmic reticulum resident protein 31 ; ERp31

UniProt

P30040

Expression Region

40-251aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-100 1x 100 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF568 conjugate, 0.1mg/mL
BNC682540-500 1x 500 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7/17 (C-46), CF647 conjugate, 0.1mg/mL
BNC470949-100 1x 100 µL

Cytokeratin 7/17 (C-46), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF647 conjugate, 0.1mg/mL
BNC471884-500 1x 500 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF568 conjugate, 0.1mg/mL
BNC682386-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details