Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GTPase ERas (ERAS), partial

Recombinant Human GTPase ERas (ERAS), partial

Product Specifications

Product Name Alternative

Embryonic stem cell-expressed Ras

UniProt

Q7Z444

Expression Region

3-230aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KR2_EBV Antibody
MBS9418888-01 0.05 mL

KR2_EBV Antibody

Sign In for Pricing
View Details
KR2_EBV Antibody
MBS9418888-02 0.1 mL

KR2_EBV Antibody

Sign In for Pricing
View Details
KR2_EBV Antibody
MBS9418888-03 5x 0.1 mL

KR2_EBV Antibody

Sign In for Pricing
View Details
C2orf3 sgRNA CRISPR Lentivector (Human) (Target 3)
K0221904 1.0 µg DNA

C2orf3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein
TP304895L 1 mg

p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein

Sign In for Pricing
View Details
PCDH1 antibody
70R-6115 100 µL

PCDH1 antibody

Sign In for Pricing
View Details