Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Fibroblast growth factor 2 (FGF2)

Recombinant Bovine Fibroblast growth factor 2 (FGF2)

Product Specifications

Product Name Alternative

(FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)

UniProt

P03969

Expression Region

10-155aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Beta-site APP-Cleaving Enzyme 1 (BACE1) ELISA Kit
RK07215 96 Tests

Rat Beta-site APP-Cleaving Enzyme 1 (BACE1) ELISA Kit

Sign In for Pricing
View Details
1-N,3-N,4-Trimethylbenzene-1,3-diamine dihydrochloride
WGC60126-01 50 mg

1-N,3-N,4-Trimethylbenzene-1,3-diamine dihydrochloride

Sign In for Pricing
View Details
1-N,3-N,4-Trimethylbenzene-1,3-diamine dihydrochloride
WGC60126-02 0.5 g

1-N,3-N,4-Trimethylbenzene-1,3-diamine dihydrochloride

Sign In for Pricing
View Details
PGP9.5 / UchL1 (pan-Neuronal Marker) Mouse Monoclonal Antibody
MBS438216-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

PGP9.5 / UchL1 (pan-Neuronal Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PGP9.5 / UchL1 (pan-Neuronal Marker) Mouse Monoclonal Antibody
MBS438216-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

PGP9.5 / UchL1 (pan-Neuronal Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PGP9.5 / UchL1 (pan-Neuronal Marker) Mouse Monoclonal Antibody
MBS438216-03 0.1 mg (Without BSA & Azide at 1mg/mL)

PGP9.5 / UchL1 (pan-Neuronal Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details