Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)
Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)
Product Specifications
Product Name Alternative
B-cell maturation protein (CD_antigen: CD269) (BCM) (BCMA)
UniProt
Q02223
Expression Region
1-54aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology; Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
1Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody. The EC50 is 5.652-7.215 ng/mL. 2Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody. The EC50 is 2.296-2.754ng/mL. 3Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody. The EC50 is 14.97-19.19 ng/mL. 4Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Human TNFSF13 protein. The EC50 is 4.217-5.674 ng/mL. 5Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Human TNFSF13B protein. The EC50 is 4.346-5.534 ng/mL.
Form
Lyophilized powder
Molecular Weight
7.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog