Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)

Product Specifications

Product Name Alternative

B-cell maturation protein (CD_antigen: CD269) (BCM) (BCMA)

UniProt

Q02223

Expression Region

1-54aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody. The EC50 is 5.652-7.215 ng/mL. 2Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody. The EC50 is 2.296-2.754ng/mL. 3Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody. The EC50 is 14.97-19.19 ng/mL. 4Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Human TNFSF13 protein. The EC50 is 4.217-5.674 ng/mL. 5Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Human TNFSF13B protein. The EC50 is 4.346-5.534 ng/mL.

Form

Lyophilized powder

Molecular Weight

7.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-100 1x 100 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-100 1x 100 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-500 1x 500 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details