Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Product Specifications

Expression Region

984-1040aa

Tag

N-terminal 6xHis-TrxA-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NFLKKCFPEYTPNFEGYCLNGHVCIYFGIANLFSCHCPIGYPGKRGEYIDFDGWDPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-CF®594
#80035 1x 1 mg

Biotin-CF®594

Sign In for Pricing
View Details
Tissue FFPE Sections, Pleura
CS801488 5x 5 µm

Tissue FFPE Sections, Pleura

Sign In for Pricing
View Details
ZNF304 Human Gene Knockout Kit (CRISPR)
KN423527 1 Kit

ZNF304 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human NECAP2 activation kit by CRISPRa
GA110901 1 Kit

Human NECAP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Medetomidine-d5 (d5-Major)
TRC-M203257-2.5MG 2.5 mg

Medetomidine-d5 (d5-Major)

Sign In for Pricing
View Details
Human DENND1B activation kit by CRISPRa
GA116090 1 Kit

Human DENND1B activation kit by CRISPRa

Sign In for Pricing
View Details