Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Product Specifications

Expression Region

984-1040aa

Tag

N-terminal 6xHis-NusA-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NFLKKCFPEYTPNFEGYCLNGHVCIYFGIANLFSCHCPIGYPGKRGEYIDFDGWDPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-36 alpha Recombinant Protein Tag Free Lyophilized
MBS8432473 Inquire

Human IL-36 alpha Recombinant Protein Tag Free Lyophilized

Sign In for Pricing
View Details
HIST1H3A Recombinant Monoclonal Antibody [28H10]
A73872-050 50 µL

HIST1H3A Recombinant Monoclonal Antibody [28H10]

Sign In for Pricing
View Details
Mouse Deoxyribonuclease I ELISA Kit
IMSDNASE1KT 1 Each

Mouse Deoxyribonuclease I ELISA Kit

Sign In for Pricing
View Details
LINC00472 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
26775061 1.0 µg DNA

LINC00472 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TRPC4AP Protein Vector (Mouse) (pPM-C-HA)
PV242032 500 ng

TRPC4AP Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
FGF17 (NM_003867) Human Tagged Lenti ORF Clone
RC211274L3 10 µg

FGF17 (NM_003867) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details