Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Product Specifications

Expression Region

990-1046aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPEYTPNFEGYCLNGHVCIYFGIANLFSCHCPIGYPGKRGEYIDFDGWDPHSAGRGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS703751 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Hcfc1r1 (NM_181821) Mouse Tagged ORF Clone
MG200577 10 µg

Hcfc1r1 (NM_181821) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PTPD1 (PTPN21) (NM_007039) Human Recombinant Protein
TP320032L 1 mg

PTPD1 (PTPN21) (NM_007039) Human Recombinant Protein

Sign In for Pricing
View Details
GCNF (NR6A1) Rabbit Polyclonal Antibody
TA361435 100 µL

GCNF (NR6A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IgE, AlpHcAbs® Goat
HA710299 100 µg

Human IgE, AlpHcAbs® Goat

Sign In for Pricing
View Details
SOX2 (Embryonic Stem Cell Marker) (rSOX2/1791), CF405S conjugate, 0.1mg/mL
BNC043648-500 1x 500 µL

SOX2 (Embryonic Stem Cell Marker) (rSOX2/1791), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details