Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Product Specifications

Expression Region

990-1046aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPEYTPNFEGYCLNGHVCIYFGIANLFSCHCPIGYPGKRGEYIDFDGWDPHSAGRGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzo[a]pyrene-6,12-quinone
TRC-B205870-1MG 1 mg

Benzo[a]pyrene-6,12-quinone

Sign In for Pricing
View Details
PAX1 (N-term) Rabbit Polyclonal Antibody
AP53178PU-N 400 µL

PAX1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS628989 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
VAMP8 (NM_003761) Human Over-expression Lysate
LC401238 20 µg

VAMP8 (NM_003761) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Chlorophenyl Cyclopentyl-d9 Ketone
TRC-C377822-25MG 25 mg

2-Chlorophenyl Cyclopentyl-d9 Ketone

Sign In for Pricing
View Details
Indo-1, pentasodium salt
21044-AAT 1 mg

Indo-1, pentasodium salt

Sign In for Pricing
View Details