Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interferon gamma (Ifng)

Recombinant Rat Interferon gamma (Ifng)

Product Specifications

Product Name Alternative

IFN-gamma

UniProt

P01581

Expression Region

23-156aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Endometrium
CR560754 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
3-Hydroxy-4-(1-naphthalenyloxy)-butanimidamide Hydrochloride
TRC-H951095-50MG 50 mg

3-Hydroxy-4-(1-naphthalenyloxy)-butanimidamide Hydrochloride

Sign In for Pricing
View Details
Mouse Kidney Injury Molecule 1 (Kim1) ELISA Kit
RDR-Kim1-Mu-01 96 Tests

Mouse Kidney Injury Molecule 1 (Kim1) ELISA Kit

Sign In for Pricing
View Details
Mouse Kidney Injury Molecule 1 (Kim1) ELISA Kit
RDR-Kim1-Mu-02 48 Tests

Mouse Kidney Injury Molecule 1 (Kim1) ELISA Kit

Sign In for Pricing
View Details
Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), CF568 conjugate, 0.1mg/mL
BNC682268-500 1x 500 µL

Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Betafluor
LS-151 4 L

Betafluor

Sign In for Pricing
View Details