Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human STEAP4&STEAP1 Heterodimer Protein-VLPs

Recombinant Human STEAP4&STEAP1 Heterodimer Protein-VLPs

Product Specifications

UniProt

Q687X5, Q9UHE8

Expression Region

1-459aa&1-339aa

Tag

C-terminal Flag-tagged&C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

53 kDa&41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAWALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQGSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIYPYVYEKKDNTFRMAISIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWMLCRKQLGLVALGFAFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH&MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2CD4B Peptide - middle region (AAP66133)
AAP66133-100UG 100 µg

C2CD4B Peptide - middle region (AAP66133)

Sign In for Pricing
View Details
Axin1 Antibody
MBS8501156-01 0.1 mg

Axin1 Antibody

Sign In for Pricing
View Details
Axin1 Antibody
MBS8501156-02 0.1 mL (AF405L)

Axin1 Antibody

Sign In for Pricing
View Details
Axin1 Antibody
MBS8501156-03 0.1 mL (AF405S)

Axin1 Antibody

Sign In for Pricing
View Details
Axin1 Antibody
MBS8501156-04 0.1 mL (AF610)

Axin1 Antibody

Sign In for Pricing
View Details
Axin1 Antibody
MBS8501156-05 0.1 mL (AF635)

Axin1 Antibody

Sign In for Pricing
View Details